PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_34417
Common NameKK1_035838
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 207aa    MW: 23418.6 Da    PI: 9.8
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_34417genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv  ++++G g+W++ ++  g+ R++k+c++rw +yl
    C.cajan_34417 13 KGPWTAEEDHILVSHIQRYGHGNWRALPKQAGLLRCGKSCRLRWINYL 60
                     79******************************99************97 PP

2Myb_DNA-binding54.42.9e-1766111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W++Ia+ ++ gRt++++k++w+++l
    C.cajan_34417  66 RGKFSKEEEDTILKLHQILGNR-WSAIAASLP-GRTDNEIKNFWHTHL 111
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25463IPR009057Homeodomain-like
PROSITE profilePS5129416.159860IPR017930Myb domain
SuperFamilySSF466894.3E-319107IPR009057Homeodomain-like
SMARTSM007172.3E-121262IPR001005SANT/Myb domain
PfamPF002491.8E-151360IPR001005SANT/Myb domain
CDDcd001673.23E-101560No hitNo description
PROSITE profilePS5129425.8761115IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-2764115IPR009057Homeodomain-like
SMARTSM007171.2E-1665113IPR001005SANT/Myb domain
PfamPF002493.7E-1666111IPR001005SANT/Myb domain
CDDcd001673.05E-1268111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MRTPCCERMG LKKGPWTAEE DHILVSHIQR YGHGNWRALP KQAGLLRCGK SCRLRWINYL  60
RPDIKRGKFS KEEEDTILKL HQILGNRWSA IAASLPGRTD NEIKNFWHTH LKKRIEKSGV  120
LHNGNAYASS HMILQEAQDA SSTSSSVTGN MMIANYGLAS RKNPPFVGTG FYGAVSSNTF  180
MGNHDSCQLS EEMEFWYNIF IKSGQTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281111525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1391441e-117BT139144.1 Lotus japonicus clone JCVI-FLLj-18J9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147213.11e-121hypothetical protein PHAVU_006G105200g
SwissprotQ7XBH48e-75MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A151RJI81e-157A0A151RJI8_CAJCA; Myb-related protein Myb4
STRINGGLYMA19G43740.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-72myb domain protein 15